Lineage for d1eqhb1 (1eqh B:74-583)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49663Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 49664Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 49807Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 49819Protein Prostaglandin H2 synthase [48136] (2 species)
  7. 49845Species Sheep (Ovis aries) [TaxId:9940] [48137] (13 PDB entries)
  8. 49849Domain d1eqhb1: 1eqh B:74-583 [59493]
    Other proteins in same PDB: d1eqha2, d1eqhb2

Details for d1eqhb1

PDB Entry: 1eqh (more details), 2.7 Å

PDB Description: the 2.7 angstrom model of ovine cox-1 complexed with flurbiprofen

SCOP Domain Sequences for d1eqhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqhb1 a.93.1.2 (B:74-583) Prostaglandin H2 synthase {Sheep (Ovis aries)}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvp

SCOP Domain Coordinates for d1eqhb1:

Click to download the PDB-style file with coordinates for d1eqhb1.
(The format of our PDB-style files is described here.)

Timeline for d1eqhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eqhb2