SCOP 1.69: Domain d1eqha2: 1eqh A:33-73

Lineage for d1eqha2 (1eqh A:33-73)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (21 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (17 PDB entries)

8. Domain d1eqha2: 1eqh A:33-73 [59492]
   Other proteins in same PDB: d1eqha1, d1eqhb1

Details for d1eqha2

PDB Entry: 1eqh, 2.7 Å

PDB Description: the 2.7 angstrom model of ovine cox-1 complexed with flurbiprofen

SCOP Domain Sequences for d1eqha2:

Sequence; same for both SEQRES and ATOM records:

>d1eqha2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1eqha2:

• d1eqha2 first appeared in SCOP 1.57
  
• d1eqha2 appears in SCOP 1.67
  
• d1eqha2 appears in SCOP 1.71
  
• d1eqha2 appears in the current release, SCOPe 2.08