Lineage for d1eqgb2 (1eqg B:33-73)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88938Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 88964Species Sheep (Ovis aries) [TaxId:9940] [57211] (13 PDB entries)
  8. 88966Domain d1eqgb2: 1eqg B:33-73 [59490]
    Other proteins in same PDB: d1eqga1, d1eqgb1

Details for d1eqgb2

PDB Entry: 1eqg (more details), 2.61 Å

PDB Description: the 2.6 angstrom model of ovine cox-1 complexed with ibuprofen

SCOP Domain Sequences for d1eqgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqgb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOP Domain Coordinates for d1eqgb2:

Click to download the PDB-style file with coordinates for d1eqgb2.
(The format of our PDB-style files is described here.)

Timeline for d1eqgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eqgb1