Lineage for d1eqga2 (1eqg A:33-73)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636300Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2636344Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2636358Domain d1eqga2: 1eqg A:33-73 [59488]
    Other proteins in same PDB: d1eqga1, d1eqgb1
    complexed with bog, hem, ibp, nag

Details for d1eqga2

PDB Entry: 1eqg (more details), 2.61 Å

PDB Description: the 2.6 angstrom model of ovine cox-1 complexed with ibuprofen
PDB Compounds: (A:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1eqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqga2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d1eqga2:

Click to download the PDB-style file with coordinates for d1eqga2.
(The format of our PDB-style files is described here.)

Timeline for d1eqga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eqga1