Lineage for d1eqga2 (1eqg A:33-73)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342254Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 342280Species Sheep (Ovis aries) [TaxId:9940] [57211] (15 PDB entries)
  8. 342281Domain d1eqga2: 1eqg A:33-73 [59488]
    Other proteins in same PDB: d1eqga1, d1eqgb1

Details for d1eqga2

PDB Entry: 1eqg (more details), 2.61 Å

PDB Description: the 2.6 angstrom model of ovine cox-1 complexed with ibuprofen

SCOP Domain Sequences for d1eqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqga2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOP Domain Coordinates for d1eqga2:

Click to download the PDB-style file with coordinates for d1eqga2.
(The format of our PDB-style files is described here.)

Timeline for d1eqga2:

342281
d1eqga2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1eqga1