Lineage for d1eq3a_ (1eq3 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies) Superfamily d.26.1: FKBP-like [54534] (2 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins) 
Protein Parvulin [64248] (1 species) Species Human (Homo sapiens), hpar14 [TaxId:9606] [64249] (2 PDB entries) 
Domain d1eq3a_: 1eq3 A: [59486]
Details for d1eq3a_
PDB Entry: 1eq3 (more details)
PDB Description: nmr structure of human parvulin hpar14
SCOP Domain Sequences for d1eq3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14}
navkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtrgsmvgpfq
eaafalpvsgmdkpvftdppvktkfgyhiimvegrk
SCOP Domain Coordinates for d1eq3a_:
Click to download the PDB-style file with coordinates for d1eq3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eq3a_:
- d1eq3a_ is new in SCOP 1.57
- d1eq3a_ appears in SCOP 1.59
- d1eq3a_ appears in the current release, SCOPe 2.08
View in 3D