Lineage for d1eq3a_ (1eq3 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. Protein Parvulin [64248] (1 species)
  7. Species Human (Homo sapiens), hpar14 [TaxId:9606] [64249] (2 PDB entries)
  8. Domain d1eq3a_: 1eq3 A: [59486]
    has additional insertions and/or extensions that are not grouped together

Details for d1eq3a_

PDB Entry: 1eq3 (more details)

PDB Description: nmr structure of human parvulin hpar14
PDB Compounds: (A:) peptidyl-prolyl cis/trans isomerase (ppiase)

SCOPe Domain Sequences for d1eq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]}
navkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtrgsmvgpfq
eaafalpvsgmdkpvftdppvktkfgyhiimvegrk

SCOPe Domain Coordinates for d1eq3a_ are not available.

Timeline for d1eq3a_: