Lineage for d1en6d2 (1en6 D:91-205)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2553021Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2553046Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)
  8. 2553068Domain d1en6d2: 1en6 D:91-205 [59480]
    Other proteins in same PDB: d1en6a1, d1en6b1, d1en6c1, d1en6d1
    complexed with mn; mutant

Details for d1en6d2

PDB Entry: 1en6 (more details), 2 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146l mutant
PDB Compounds: (D:) manganese superoxide dismutase

SCOPe Domain Sequences for d1en6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en6d2 d.44.1.1 (D:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanldspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1en6d2:

Click to download the PDB-style file with coordinates for d1en6d2.
(The format of our PDB-style files is described here.)

Timeline for d1en6d2: