SCOPe 2.07: Domain d1en6c2: 1en6 C:91-205

Lineage for d1en6c2 (1en6 C:91-205)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)

8. Domain d1en6c2: 1en6 C:91-205 [59478]
   Other proteins in same PDB: d1en6a1, d1en6b1, d1en6c1, d1en6d1
   complexed with mn; mutant

Details for d1en6c2

PDB Entry: 1en6, 2 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146l mutant

PDB Compounds: (C:) manganese superoxide dismutase

SCOPe Domain Sequences for d1en6c2:

Sequence; same for both SEQRES and ATOM records:

>d1en6c2 d.44.1.1 (C:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanldspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1en6c2:

• d1en6c2 first appeared in SCOP 1.57
  
• d1en6c2 appears in SCOPe 2.06
  
• d1en6c2 appears in the current release, SCOPe 2.08