Lineage for d1en6b2 (1en6 B:91-205)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503030Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 503031Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 503032Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 503144Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 503155Species Escherichia coli [TaxId:562] [54722] (10 PDB entries)
  8. 503171Domain d1en6b2: 1en6 B:91-205 [59476]
    Other proteins in same PDB: d1en6a1, d1en6b1, d1en6c1, d1en6d1

Details for d1en6b2

PDB Entry: 1en6 (more details), 2 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146l mutant

SCOP Domain Sequences for d1en6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en6b2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanldspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1en6b2:

Click to download the PDB-style file with coordinates for d1en6b2.
(The format of our PDB-style files is described here.)

Timeline for d1en6b2: