Lineage for d1en5d1 (1en5 D:1-90)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256628Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1256758Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1256778Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)
  8. 1256814Domain d1en5d1: 1en5 D:1-90 [59471]
    Other proteins in same PDB: d1en5a2, d1en5b2, d1en5c2, d1en5d2
    complexed with mn; mutant

Details for d1en5d1

PDB Entry: 1en5 (more details), 2.3 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase y34f mutant
PDB Compounds: (D:) manganese superoxide dismutase

SCOPe Domain Sequences for d1en5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en5d1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtfvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOPe Domain Coordinates for d1en5d1:

Click to download the PDB-style file with coordinates for d1en5d1.
(The format of our PDB-style files is described here.)

Timeline for d1en5d1: