| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (6 species) |
| Species Escherichia coli [TaxId:562] [46620] (10 PDB entries) |
| Domain d1en5d1: 1en5 D:1-90 [59471] Other proteins in same PDB: d1en5a2, d1en5b2, d1en5c2, d1en5d2 complexed with mw1; mutant |
PDB Entry: 1en5 (more details), 2.3 Å
SCOP Domain Sequences for d1en5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1en5d1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli}
sytlpslpyaydalephfdkqtmeihhtkhhqtfvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1en5d1: