Lineage for d1en5c2 (1en5 C:91-205)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79570Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 79571Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 79572Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 79623Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)
  7. 79624Species Escherichia coli [TaxId:562] [54722] (8 PDB entries)
  8. 79645Domain d1en5c2: 1en5 C:91-205 [59470]
    Other proteins in same PDB: d1en5a1, d1en5b1, d1en5c1, d1en5d1

Details for d1en5c2

PDB Entry: 1en5 (more details), 2.3 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase y34f mutant
PDB Compounds: (C:)

SCOP Domain Sequences for d1en5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en5c2 d.44.1.1 (C:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1en5c2:

Click to download the PDB-style file with coordinates for d1en5c2.
(The format of our PDB-style files is described here.)

Timeline for d1en5c2: