Lineage for d1en4d1 (1en4 D:1-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303638Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2303663Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)
  8. 2303677Domain d1en4d1: 1en4 D:1-90 [59463]
    Other proteins in same PDB: d1en4a2, d1en4b2, d1en4c2, d1en4d2
    complexed with mn; mutant

Details for d1en4d1

PDB Entry: 1en4 (more details), 2 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant
PDB Compounds: (D:) manganese superoxide dismutase

SCOPe Domain Sequences for d1en4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en4d1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOPe Domain Coordinates for d1en4d1:

Click to download the PDB-style file with coordinates for d1en4d1.
(The format of our PDB-style files is described here.)

Timeline for d1en4d1: