Lineage for d1elva1 (1elv A:410-668)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056272Protein Complement C1S protease, catalytic domain [63789] (1 species)
  7. 2056273Species Human (Homo sapiens) [TaxId:9606] [63790] (1 PDB entry)
  8. 2056274Domain d1elva1: 1elv A:410-668 [59454]
    Other proteins in same PDB: d1elva2
    complexed with nes, so4

Details for d1elva1

PDB Entry: 1elv (more details), 1.7 Å

PDB Description: crystal structure of the catalytic domain of human complement c1s protease
PDB Compounds: (A:) Complement C1s component

SCOPe Domain Sequences for d1elva1:

Sequence, based on SEQRES records: (download)

>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgvprepfeekqriiggsdadiknfpwqvffdnpwaggalineywvltaahvvegnrept
myvgstsvqtsrlakskmltpehvfihpgwkllavpegrtnfdndialvrlkdpvkmgpt
vspiclpgtssdynlmdgdlglisgwgrtekrdravrlkaarlpvaplrkckevkvekpt
adaeayvftpnmicaggekgmdsckgdsggafavqdpndktkfyaaglvswgpqcgtygl
ytrvknyvdwimktmqens

Sequence, based on observed residues (ATOM records): (download)

>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgvprepfiiggsdadiknfpwqvffdnpwaggalineywvltaahvvegnreptmyvgs
tsvqkmltpehvfihpgwkllavpegrtnfdndialvrlkdpvkmgptvspiclpgtssd
ynlmdgdlglisgwgrtekrdravrlkaarlpvaplrkckevayvftpnmicaggekgmd
sckgdsggafavqdpndktkfyaaglvswgpqcgtyglytrvknyvdwimktmqens

SCOPe Domain Coordinates for d1elva1:

Click to download the PDB-style file with coordinates for d1elva1.
(The format of our PDB-style files is described here.)

Timeline for d1elva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1elva2