Lineage for d1el4a_ (1el4 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 640903Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 640906Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (7 PDB entries)
  8. 640910Domain d1el4a_: 1el4 A: [59453]
    complexed with cl, ctz

Details for d1el4a_

PDB Entry: 1el4 (more details), 1.73 Å

PDB Description: structure of the calcium-regulated photoprotein obelin determined by sulfur sas
PDB Compounds: (A:) obelin

SCOP Domain Sequences for d1el4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el4a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
sskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglygngvp

SCOP Domain Coordinates for d1el4a_:

Click to download the PDB-style file with coordinates for d1el4a_.
(The format of our PDB-style files is described here.)

Timeline for d1el4a_: