![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (3 PDB entries) |
![]() | Domain d1el1b_: 1el1 B: [59452] holo-form |
PDB Entry: 1el1 (more details), 1.9 Å
SCOP Domain Sequences for d1el1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1el1b_ d.2.1.2 (B:) Lysozyme {Dog (Canis familiaris), milk} skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd lskylascnl
Timeline for d1el1b_: