Lineage for d1el1a_ (1el1 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887115Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1887815Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)
  8. 1887817Domain d1el1a_: 1el1 A: [59451]
    holo-form
    complexed with ca

Details for d1el1a_

PDB Entry: 1el1 (more details), 1.9 Å

PDB Description: x-ray crystal structure analysis of canine milk lysozyme (holo-type)
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1el1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el1a_ d.2.1.2 (A:) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

SCOPe Domain Coordinates for d1el1a_:

Click to download the PDB-style file with coordinates for d1el1a_.
(The format of our PDB-style files is described here.)

Timeline for d1el1a_: