Lineage for d1el1a_ (1el1 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76272Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (2 PDB entries)
  8. 76274Domain d1el1a_: 1el1 A: [59451]

Details for d1el1a_

PDB Entry: 1el1 (more details), 1.9 Å

PDB Description: x-ray crystal structure analysis of canine milk lysozyme (holo-type)
PDB Compounds: (A:)

SCOP Domain Sequences for d1el1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el1a_ d.2.1.2 (A:) Lysozyme {Dog (Canis familiaris), milk}
skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

SCOP Domain Coordinates for d1el1a_:

Click to download the PDB-style file with coordinates for d1el1a_.
(The format of our PDB-style files is described here.)

Timeline for d1el1a_: