Lineage for d1ekva_ (1ekv A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87235Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
  4. 87236Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 87237Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 87241Protein Branched-chain amino acid aminotransferase [56757] (2 species)
  7. 87255Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (3 PDB entries)
  8. 87260Domain d1ekva_: 1ekv A: [59449]

Details for d1ekva_

PDB Entry: 1ekv (more details), 2.25 Å

PDB Description: human branched chain amino acid aminotransferase (mitochondrial): three dimensional structure of enzyme inactivated by tris bound to the pyridoxal-5'-phosphate on one end and active site lys202 nz on the other.

SCOP Domain Sequences for d1ekva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekva_ e.17.1.1 (A:) Branched-chain amino acid aminotransferase {Human (Homo sapiens), mitochondrial}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv

SCOP Domain Coordinates for d1ekva_:

Click to download the PDB-style file with coordinates for d1ekva_.
(The format of our PDB-style files is described here.)

Timeline for d1ekva_: