Lineage for d1ekpa_ (1ekp A:)
- Root: SCOP 1.57
Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds) 
Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) 
Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins) 
Protein Branched-chain amino acid aminotransferase [56757] (2 species) 
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (3 PDB entries) 
Domain d1ekpa_: 1ekp A: [59447]
Details for d1ekpa_
PDB Entry: 1ekp (more details), 2.5 Å
PDB Description: crystal structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'-phosphate at 2.5 angstroms (monoclinic form).
SCOP Domain Sequences for d1ekpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekpa_ e.17.1.1 (A:) Branched-chain amino acid aminotransferase {Human (Homo sapiens), mitochondrial}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv
SCOP Domain Coordinates for d1ekpa_:
Click to download the PDB-style file with coordinates for d1ekpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ekpa_:
- d1ekpa_ is new in SCOP 1.57
- d1ekpa_ appears in SCOP 1.59
- d1ekpa_ appears in the current release, SCOPe 2.08
View in 3D
