Lineage for d1ekfb_ (1ekf B:)
- Root: SCOPe 2.08
- Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
- Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 - Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)
- Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
- Protein Branched-chain aminoacid aminotransferase [56757] (2 species)
- Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (26 PDB entries)
- Domain d1ekfb_: 1ekf B: [59446]
complexed with plp
Details for d1ekfb_
PDB Entry: 1ekf (more details), 1.95 Å
PDB Description: crystallographic structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'-phosphate at 1.95 angstroms (orthorhombic form)
PDB Compounds: (B:) branched chain amino acid aminotransferase (mitochondrial)SCOPe Domain Sequences for d1ekfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekfb_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv
SCOPe Domain Coordinates for d1ekfb_ are not available.
Timeline for d1ekfb_:
- d1ekfb_ first appeared in SCOP 1.57
- d1ekfb_ appears in SCOPe 2.07