SCOPe 2.08: Domain d1ekfb_: 1ekf B:

Lineage for d1ekfb_ (1ekf B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein Branched-chain aminoacid aminotransferase [56757] (2 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (26 PDB entries)

8. Domain d1ekfb_: 1ekf B: [59446]
   complexed with plp

Details for d1ekfb_

PDB Entry: 1ekf, 1.95 Å

PDB Description: crystallographic structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'-phosphate at 1.95 angstroms (orthorhombic form)

PDB Compounds: (B:) branched chain amino acid aminotransferase (mitochondrial)

SCOPe Domain Sequences for d1ekfb_:

Sequence; same for both SEQRES and ATOM records:

>d1ekfb_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv

Timeline for d1ekfb_:

• d1ekfb_ first appeared in SCOP 1.57
  
• d1ekfb_ appears in SCOPe 2.07