Lineage for d1ek3b_ (1ek3 B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220089Species Kappa-4 VL REC (human) [63650] (1 PDB entry)
  8. 220091Domain d1ek3b_: 1ek3 B: [59435]
    complexed with ca, cl

Details for d1ek3b_

PDB Entry: 1ek3 (more details), 1.9 Å

PDB Description: kappa-4 immunoglobulin vl, rec

SCOP Domain Sequences for d1ek3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek3b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Kappa-4 VL REC (human)}
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr

SCOP Domain Coordinates for d1ek3b_:

Click to download the PDB-style file with coordinates for d1ek3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ek3b_: