SCOP 1.65: Domain d1ek3a_: 1ek3 A:

Lineage for d1ek3a_ (1ek3 A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d1ek3a_: 1ek3 A: [59434]

Details for d1ek3a_

PDB Entry: 1ek3, 1.9 Å

PDB Description: kappa-4 immunoglobulin vl, rec

SCOP Domain Sequences for d1ek3a_:

Sequence; same for both SEQRES and ATOM records:

>d1ek3a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2}
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr

Timeline for d1ek3a_:

• d1ek3a_ first appeared in SCOP 1.57
  
• d1ek3a_ appears in SCOP 1.63
  
• d1ek3a_ appears in SCOP 1.67
  
• d1ek3a_ appears in the current release, SCOPe 2.08