Lineage for d1ejmc_ (1ejm C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065466Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
    Uniprot P00760
  8. 2065800Domain d1ejmc_: 1ejm C: [59426]
    Other proteins in same PDB: d1ejmb_, d1ejmd_, d1ejmf_
    complexed with so4; mutant

Details for d1ejmc_

PDB Entry: 1ejm (more details), 1.85 Å

PDB Description: crystal structure of the bpti ala16leu mutant in complex with bovine trypsin
PDB Compounds: (C:) beta-trypsin

SCOPe Domain Sequences for d1ejmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejmc_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1ejmc_:

Click to download the PDB-style file with coordinates for d1ejmc_.
(The format of our PDB-style files is described here.)

Timeline for d1ejmc_: