SCOP 1.73: Domain d1ejmc_: 1ejm C:

Lineage for d1ejmc_ (1ejm C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)

8. Domain d1ejmc_: 1ejm C: [59426]
   Other proteins in same PDB: d1ejmb_, d1ejmd_, d1ejmf_

Details for d1ejmc_

PDB Entry: 1ejm, 1.85 Å

PDB Description: crystal structure of the bpti ala16leu mutant in complex with bovine trypsin

PDB Compounds: (C:) beta-trypsin

SCOP Domain Sequences for d1ejmc_:

Sequence; same for both SEQRES and ATOM records:

>d1ejmc_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1ejmc_:

• d1ejmc_ first appeared in SCOP 1.57
  
• d1ejmc_ appears in SCOP 1.71
  
• d1ejmc_ appears in SCOP 1.75
  
• d1ejmc_ appears in the current release, SCOPe 2.08