SCOPe 2.07: Domain d1ejma_: 1ejm A:

Lineage for d1ejma_ (1ejm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
   Uniprot P00760

8. Domain d1ejma_: 1ejm A: [59424]
   Other proteins in same PDB: d1ejmb_, d1ejmd_, d1ejmf_
   complexed with so4; mutant

Details for d1ejma_

PDB Entry: 1ejm, 1.85 Å

PDB Description: crystal structure of the bpti ala16leu mutant in complex with bovine trypsin

PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1ejma_:

Sequence; same for both SEQRES and ATOM records:

>d1ejma_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1ejma_:

• d1ejma_ first appeared in SCOP 1.57
  
• d1ejma_ appears in SCOPe 2.06
  
• d1ejma_ appears in the current release, SCOPe 2.08