SCOP 1.59: Domain d1ejja1: 1ejj A:77-310

Lineage for d1ejja1 (1ejj A:77-310)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.105: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64157] (1 superfamily)

4. Superfamily c.105.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64158] (1 family)

5. Family c.105.1.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64159] (1 protein)

6. Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64160] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [64161] (2 PDB entries)

8. Domain d1ejja1: 1ejj A:77-310 [59422]
   Other proteins in same PDB: d1ejja2

Details for d1ejja1

PDB Entry: 1ejj, 1.9 Å

PDB Description: crystal structural analysis of phosphoglycerate mutase cocrystallized with 3-phosphoglycerate

SCOP Domain Sequences for d1ejja1:

Sequence; same for both SEQRES and ATOM records:

>d1ejja1 c.105.1.1 (A:77-310) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain {Bacillus stearothermophilus}
qsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggvhshihhlyallrla
akegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatlsgryysmdrdkrwd
rvekayramvygegptyrdpleciedsykhgiydefvlpsvivredgrpvatiqdndaii
fynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetvagyvafkp

Timeline for d1ejja1:

• d1ejja1 first appeared in SCOP 1.57
  
• d1ejja1 appears in SCOP 1.61
  
• d1ejja1 appears in the current release, SCOPe 2.08