![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
![]() | Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
![]() | Protein Lumazine synthase [52123] (7 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry) |
![]() | Domain d1ejbc_: 1ejb C: [59419] complexed with inj |
PDB Entry: 1ejb (more details), 1.85 Å
SCOPe Domain Sequences for d1ejbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejbc_ c.16.1.1 (C:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf
Timeline for d1ejbc_:
![]() Domains from other chains: (mouse over for more information) d1ejba_, d1ejbb_, d1ejbd_, d1ejbe_ |