Lineage for d1ejbc_ (1ejb C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67948Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 67949Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 67950Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 67951Protein Lumazine synthase [52123] (5 species)
  7. 67983Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry)
  8. 67986Domain d1ejbc_: 1ejb C: [59419]

Details for d1ejbc_

PDB Entry: 1ejb (more details), 1.85 Å

PDB Description: lumazine synthase from saccharomyces cerevisiae

SCOP Domain Sequences for d1ejbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejbc_ c.16.1.1 (C:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae)}
avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf

SCOP Domain Coordinates for d1ejbc_:

Click to download the PDB-style file with coordinates for d1ejbc_.
(The format of our PDB-style files is described here.)

Timeline for d1ejbc_: