Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein Lumazine synthase [52123] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry) |
Domain d1ejba_: 1ejb A: [59417] complexed with inj |
PDB Entry: 1ejb (more details), 1.85 Å
SCOPe Domain Sequences for d1ejba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf
Timeline for d1ejba_:
View in 3D Domains from other chains: (mouse over for more information) d1ejbb_, d1ejbc_, d1ejbd_, d1ejbe_ |