SCOPe 2.06: Domain d1ejba_: 1ejb A:

Lineage for d1ejba_ (1ejb A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.16.1: Lumazine synthase [52121] (2 families)

5. Family c.16.1.1: Lumazine synthase [52122] (2 proteins)

6. Protein Lumazine synthase [52123] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry)

8. Domain d1ejba_: 1ejb A: [59417]
   complexed with inj

Details for d1ejba_

PDB Entry: 1ejb, 1.85 Å

PDB Description: lumazine synthase from saccharomyces cerevisiae

PDB Compounds: (A:) lumazine synthase

SCOPe Domain Sequences for d1ejba_:

Sequence; same for both SEQRES and ATOM records:

>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf

Timeline for d1ejba_:

• d1ejba_ first appeared in SCOP 1.57
  
• d1ejba_ appears in SCOPe 2.05
  
• d1ejba_ appears in SCOPe 2.07
  
• d1ejba_ appears in the current release, SCOPe 2.08