SCOP 1.57: Domain d1ejba_: 1ejb A:

Lineage for d1ejba_ (1ejb A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)

4. Superfamily c.16.1: Lumazine synthase [52121] (1 family)

5. Family c.16.1.1: Lumazine synthase [52122] (1 protein)

6. Protein Lumazine synthase [52123] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry)

8. Domain d1ejba_: 1ejb A: [59417]

Details for d1ejba_

PDB Entry: 1ejb, 1.85 Å

PDB Description: lumazine synthase from saccharomyces cerevisiae

SCOP Domain Sequences for d1ejba_:

Sequence; same for both SEQRES and ATOM records:

>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae)}
avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf

Timeline for d1ejba_:

• d1ejba_ is new in SCOP 1.57
  
• d1ejba_ appears in SCOP 1.59
  
• d1ejba_ appears in the current release, SCOPe 2.08