Lineage for d1ejab_ (1eja B:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 89076Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) (S)
  5. 89077Family g.3.15.1: Huristasin-like [57263] (3 proteins)
  6. 89078Protein Bdellastasin [57266] (1 species)
  7. 89079Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57267] (3 PDB entries)
  8. 89081Domain d1ejab_: 1eja B: [59416]
    Other proteins in same PDB: d1ejaa_

Details for d1ejab_

PDB Entry: 1eja (more details), 2.7 Å

PDB Description: structure of porcine trypsin complexed with bdellastasin, an antistasin-type inhibitor
PDB Compounds: (B:)

SCOP Domain Sequences for d1ejab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejab_ g.3.15.1 (B:) Bdellastasin {Medicinal leech (Hirudo medicinalis)}
ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq

SCOP Domain Coordinates for d1ejab_:

Click to download the PDB-style file with coordinates for d1ejab_.
(The format of our PDB-style files is described here.)

Timeline for d1ejab_: