Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [63975] (6 PDB entries) |
Domain d1ej2a_: 1ej2 A: [59414] complexed with na, nad, so4 |
PDB Entry: 1ej2 (more details), 1.9 Å
SCOPe Domain Sequences for d1ej2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]} mrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltkal sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhla
Timeline for d1ej2a_: