Lineage for d1eh4b_ (1eh4 B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (16 proteins) 
Protein Casein kinase-1, CK1 [56139] (2 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries) 
Domain d1eh4b_: 1eh4 B: [59413]
Details for d1eh4b_
PDB Entry: 1eh4 (more details), 2.8 Å
PDB Description: binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261
SCOP Domain Sequences for d1eh4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eh4b_ d.144.1.1 (B:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe)}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
SCOP Domain Coordinates for d1eh4b_:
Click to download the PDB-style file with coordinates for d1eh4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eh4b_:
- d1eh4b_ is new in SCOP 1.57
- d1eh4b_ appears in SCOP 1.59
- d1eh4b_ appears in the current release, SCOPe 2.08
View in 3D
