SCOPe 2.05: Domain d1eh4a_: 1eh4 A:

Lineage for d1eh4a_ (1eh4 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Casein kinase-1, CK1 [56139] (4 species)
   OPK group; CKI subfamily; serine/threonine kinase

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries)

8. Domain d1eh4a_: 1eh4 A: [59412]
   complexed with ic1, so4

Details for d1eh4a_

PDB Entry: 1eh4, 2.8 Å

PDB Description: binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261

PDB Compounds: (A:) casein kinase-1

SCOPe Domain Sequences for d1eh4a_:

Sequence; same for both SEQRES and ATOM records:

>d1eh4a_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll

Timeline for d1eh4a_:

• d1eh4a_ first appeared in SCOP 1.57
  
• d1eh4a_ appears in SCOPe 2.04
  
• d1eh4a_ appears in SCOPe 2.06
  
• d1eh4a_ appears in the current release, SCOPe 2.08