Lineage for d1ee1b_ (1ee1 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1590911Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 1590997Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 1591007Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)
  8. 1591015Domain d1ee1b_: 1ee1 B: [59410]
    complexed with atp, dnd, mg

Details for d1ee1b_

PDB Entry: 1ee1 (more details), 2.06 Å

PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis complexed with one molecule atp, two molecules deamido-nad+ and one mg2+ ion
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1ee1b_:

Sequence, based on SEQRES records: (download)

>d1ee1b_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

Sequence, based on observed residues (ATOM records): (download)

>d1ee1b_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgeddaqlalkfikpdkswkfdikstvsafsdqyqqetgd
qltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllpltgl
tkrqgrtllkelgaperlylisydeiddylegkevsakvsealekrysmtehkrqvpasm
fddwwk

SCOPe Domain Coordinates for d1ee1b_:

Click to download the PDB-style file with coordinates for d1ee1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ee1b_: