Lineage for d1ecsa_ (1ecs A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502268Family d.32.1.2: Antibiotic resistance proteins [54598] (4 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 502269Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 502270Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries)
    the transposon tn5-encoding bleomycin-binding protein, BlmT
  8. 502271Domain d1ecsa_: 1ecs A: [59407]

Details for d1ecsa_

PDB Entry: 1ecs (more details), 1.7 Å

PDB Description: the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5

SCOP Domain Sequences for d1ecsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel

SCOP Domain Coordinates for d1ecsa_:

Click to download the PDB-style file with coordinates for d1ecsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ecsa_: