Lineage for d1eb7a2 (1eb7 A:165-323)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149762Family a.3.1.5: Di-haem cytochrome c peroxidase [46685] (1 protein)
  6. 149763Protein Di-haem cytochrome c peroxidase [46686] (2 species)
  7. 149773Species Pseudomonas aeruginosa [TaxId:287] [46687] (1 PDB entry)
  8. 149775Domain d1eb7a2: 1eb7 A:165-323 [59405]

Details for d1eb7a2

PDB Entry: 1eb7 (more details), 2.4 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa

SCOP Domain Sequences for d1eb7a2:

Sequence, based on SEQRES records: (download)

>d1eb7a2 a.3.1.5 (A:165-323) Di-haem cytochrome c peroxidase {Pseudomonas aeruginosa}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae

Sequence, based on observed residues (ATOM records): (download)

>d1eb7a2 a.3.1.5 (A:165-323) Di-haem cytochrome c peroxidase {Pseudomonas aeruginosa}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdadk
grfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddve
nivaflhslsgkqprveypllpastettprpae

SCOP Domain Coordinates for d1eb7a2:

Click to download the PDB-style file with coordinates for d1eb7a2.
(The format of our PDB-style files is described here.)

Timeline for d1eb7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eb7a1