Lineage for d1eb7a2 (1eb7 A:165-323)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (7 families) 
Family a.3.1.5: Di-haem cytochrome c peroxidase [46685] (1 protein) Protein Di-haem cytochrome c peroxidase [46686] (2 species) 
Species Pseudomonas aeruginosa [TaxId:287] [46687] (1 PDB entry) 
Domain d1eb7a2: 1eb7 A:165-323 [59405]
Details for d1eb7a2
PDB Entry: 1eb7 (more details), 2.4 Å
PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa
SCOP Domain Sequences for d1eb7a2:
Sequence, based on SEQRES records: (download)
>d1eb7a2 a.3.1.5 (A:165-323) Di-haem cytochrome c peroxidase {Pseudomonas aeruginosa}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae
Sequence, based on observed residues (ATOM records): (download)
>d1eb7a2 a.3.1.5 (A:165-323) Di-haem cytochrome c peroxidase {Pseudomonas aeruginosa}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdadk
grfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddve
nivaflhslsgkqprveypllpastettprpae
SCOP Domain Coordinates for d1eb7a2:
Click to download the PDB-style file with coordinates for d1eb7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eb7a2:
- d1eb7a2 first appeared in SCOP 1.57
- d1eb7a2 appears in SCOP 1.61
- d1eb7a2 appears in the current release, SCOPe 2.08
View in 3D
