SCOP 1.61: Domain d1eb7a1: 1eb7 A:1-164

Lineage for d1eb7a1 (1eb7 A:1-164)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.5: Di-haem cytochrome c peroxidase [46685] (1 protein)

6. Protein Di-haem cytochrome c peroxidase [46686] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [46687] (1 PDB entry)

8. Domain d1eb7a1: 1eb7 A:1-164 [59404]

Details for d1eb7a1

PDB Entry: 1eb7, 2.4 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa

SCOP Domain Sequences for d1eb7a1:

Sequence; same for both SEQRES and ATOM records:

>d1eb7a1 a.3.1.5 (A:1-164) Di-haem cytochrome c peroxidase {Pseudomonas aeruginosa}
dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv

Timeline for d1eb7a1:

• d1eb7a1 first appeared in SCOP 1.57
  
• d1eb7a1 appears in SCOP 1.59
  
• d1eb7a1 appears in SCOP 1.63
  
• d1eb7a1 appears in the current release, SCOPe 2.08