Lineage for d1eb7a1 (1eb7 A:1-164)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45277Family a.3.1.5: Di-haem cytochrome c peroxidase [46685] (1 protein)
  6. 45278Protein Di-haem cytochrome c peroxidase [46686] (1 species)
  7. 45279Species Pseudomonas aeruginosa [TaxId:287] [46687] (1 PDB entry)
  8. 45280Domain d1eb7a1: 1eb7 A:1-164 [59404]

Details for d1eb7a1

PDB Entry: 1eb7 (more details), 2.4 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa

SCOP Domain Sequences for d1eb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb7a1 a.3.1.5 (A:1-164) Di-haem cytochrome c peroxidase {Pseudomonas aeruginosa}
dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv

SCOP Domain Coordinates for d1eb7a1:

Click to download the PDB-style file with coordinates for d1eb7a1.
(The format of our PDB-style files is described here.)

Timeline for d1eb7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eb7a2