Lineage for d1eb3a_ (1eb3 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (12 PDB entries)
  8. Domain d1eb3a_: 1eb3 A: [59403]
    complexed with dsb, zn

Details for d1eb3a_

PDB Entry: 1eb3 (more details), 1.7500000000000002 Å

PDB Description: yeast 5-aminolaevulinic acid dehydratase 4,7-dioxosebacic acid complex
PDB Compounds: (A:) 5-aminolaevulinic acid dehydratase

SCOPe Domain Sequences for d1eb3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb3a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwlde

SCOPe Domain Coordinates for d1eb3a_ are not available.

Timeline for d1eb3a_: