SCOP 1.57: Domain d1ea3b_: 1ea3 B:

Lineage for d1ea3b_ (1ea3 B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (1 protein)

6. Protein Influenza virus matrix protein M1 [48147] (1 species)

7. Species Influenza virus [48148] (2 PDB entries)

8. Domain d1ea3b_: 1ea3 B: [59399]

Details for d1ea3b_

PDB Entry: 1ea3, 2.3 Å

PDB Description: influenza virus m1 protein

SCOP Domain Sequences for d1ea3b_:

Sequence; same for both SEQRES and ATOM records:

>d1ea3b_ a.95.1.1 (B:) Influenza virus matrix protein M1 {Influenza virus}
slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsq

Timeline for d1ea3b_:

• d1ea3b_ is new in SCOP 1.57
  
• d1ea3b_ appears in SCOP 1.59
  
• d1ea3b_ appears in the current release, SCOPe 2.08