Lineage for d1ea3a_ (1ea3 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49875Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
  4. 49876Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
  5. 49877Family a.95.1.1: Influenza virus matrix protein M1 [48146] (1 protein)
  6. 49878Protein Influenza virus matrix protein M1 [48147] (1 species)
  7. 49879Species Influenza virus [48148] (2 PDB entries)
  8. 49882Domain d1ea3a_: 1ea3 A: [59398]

Details for d1ea3a_

PDB Entry: 1ea3 (more details), 2.3 Å

PDB Description: influenza virus m1 protein

SCOP Domain Sequences for d1ea3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea3a_ a.95.1.1 (A:) Influenza virus matrix protein M1 {Influenza virus}
slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsq

SCOP Domain Coordinates for d1ea3a_:

Click to download the PDB-style file with coordinates for d1ea3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ea3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ea3b_