![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase-like lectin ym1 [64252] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries) |
![]() | Domain d1e9la2: 1e9l A:267-336 [59396] Other proteins in same PDB: d1e9la1 complexed with gcs |
PDB Entry: 1e9l (more details), 2.5 Å
SCOPe Domain Sequences for d1e9la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e9la2 d.26.3.1 (A:267-336) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy ayqgnewvgy
Timeline for d1e9la2: