Lineage for d1e9la1 (1e9l A:22-266,A:337-393)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570170Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1570295Protein Chitinase-like lectin ym1, saccharide binding domain [63910] (1 species)
  7. 1570296Species Mouse (Mus musculus) [TaxId:10090] [63911] (2 PDB entries)
  8. 1570298Domain d1e9la1: 1e9l A:22-266,A:337-393 [59395]
    Other proteins in same PDB: d1e9la2
    complexed with gcs

Details for d1e9la1

PDB Entry: 1e9l (more details), 2.5 Å

PDB Description: the crystal structure of novel mammalian lectin ym1 suggests a saccharide binding site
PDB Compounds: (A:) ym1 secretory protein

SCOPe Domain Sequences for d1e9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9la1 c.1.8.5 (A:22-266,A:337-393) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]}
yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
vgfpaXdnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfpltstlkgdlnih
sas

SCOPe Domain Coordinates for d1e9la1:

Click to download the PDB-style file with coordinates for d1e9la1.
(The format of our PDB-style files is described here.)

Timeline for d1e9la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9la2