Lineage for d1e9la1 (1e9l A:22-266,A:337-393)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474902Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 474987Protein Chitinase-like lectin ym1, saccharide binding domain [63910] (1 species)
  7. 474988Species Mouse (Mus musculus) [TaxId:10090] [63911] (1 PDB entry)
  8. 474989Domain d1e9la1: 1e9l A:22-266,A:337-393 [59395]
    Other proteins in same PDB: d1e9la2

Details for d1e9la1

PDB Entry: 1e9l (more details), 2.5 Å

PDB Description: the crystal structure of novel mammalian lectin ym1 suggests a saccharide binding site

SCOP Domain Sequences for d1e9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9la1 c.1.8.5 (A:22-266,A:337-393) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus)}
yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
vgfpaXdnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfpltstlkgdlnih
sas

SCOP Domain Coordinates for d1e9la1:

Click to download the PDB-style file with coordinates for d1e9la1.
(The format of our PDB-style files is described here.)

Timeline for d1e9la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9la2