Lineage for d1e9la1 (1e9l A:22-266,A:337-393)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.5: Type II chitinase [51534] (15 proteins)
glycosylase family 18
Protein Chitinase-like lectin ym1, saccharide binding domain [63910] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [63911] (2 PDB entries) 
Domain d1e9la1: 1e9l A:22-266,A:337-393 [59395]
Other proteins in same PDB: d1e9la2
complexed with gcs
Details for d1e9la1
PDB Entry: 1e9l (more details), 2.5 Å
PDB Description: the crystal structure of novel mammalian lectin ym1 suggests a saccharide binding site
PDB Compounds: (A:) ym1 secretory proteinSCOPe Domain Sequences for d1e9la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e9la1 c.1.8.5 (A:22-266,A:337-393) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]}
yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
vgfpaXdnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfpltstlkgdlnih
sas
SCOPe Domain Coordinates for d1e9la1:
Click to download the PDB-style file with coordinates for d1e9la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e9la1:
- d1e9la1 first appeared in SCOP 1.57
- d1e9la1 appears in SCOPe 2.07
View in 3D
