Lineage for d1e8vb_ (1e8v B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565371Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 565372Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 565373Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 565474Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 565475Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries)
  8. 565481Domain d1e8vb_: 1e8v B: [59392]
    complexed with ca, dan, nag

Details for d1e8vb_

PDB Entry: 1e8v (more details), 2 Å

PDB Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase

SCOP Domain Sequences for d1e8vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8vb_ b.68.1.1 (B:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilknd

SCOP Domain Coordinates for d1e8vb_:

Click to download the PDB-style file with coordinates for d1e8vb_.
(The format of our PDB-style files is described here.)

Timeline for d1e8vb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e8va_